PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.119640.1
Common NameCsa_6G121970, LOC101211981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 239aa    MW: 27968.9 Da    PI: 7.1618
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.119640.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ eEd++l  +++++G+  W+ ++r  g+ R++k+c++rw++yl
   Cucsa.119640.1 14 RGAWSLEEDQKLRAYIEKYGPWKWREVPRLAGLMRCGKSCRLRWLNYL 61
                     89******************88************************97 PP

2Myb_DNA-binding54.72.4e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T eE el+ ++++ +G++ W+tIa++++ gRt++++k++w+ +
   Cucsa.119640.1  67 RGNYTNEENELICKLHQTHGNR-WSTIAAKLP-GRTDNEVKNYWNAH 111
                      899*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.044965IPR017930Myb domain
SuperFamilySSF466896.64E-2911108IPR009057Homeodomain-like
SMARTSM007177.0E-111363IPR001005SANT/Myb domain
PfamPF002498.1E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-211568IPR009057Homeodomain-like
CDDcd001678.79E-91661No hitNo description
SMARTSM007173.5E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129419.24766116IPR017930Myb domain
PfamPF002495.3E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-2669116IPR009057Homeodomain-like
CDDcd001672.03E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MVRAPVVDKD GVKRGAWSLE EDQKLRAYIE KYGPWKWREV PRLAGLMRCG KSCRLRWLNY  60
LRPGLKRGNY TNEENELICK LHQTHGNRWS TIAAKLPGRT DNEVKNYWNA HLKKQVKPKT  120
ESSTKHEGKP KDLSLSHVYE AKTSKDFAEY CSSTFGILES SSCLSQQTSS SDDNFGTVIN  180
WRMEDYNIDQ LQISGYYDDF WTEPYVWDHN ETNAFSVDYG IEMFSPQQQY ETAYDHNYX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819181e-178LN681918.1 Cucumis melo genomic scaffold, anchoredscaffold00020.
GenBankLN7132651e-178LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004140052.20.0PREDICTED: transcription repressor MYB6-like
SwissprotQ9SZP18e-52MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A0A0KAD10.0A0A0A0KAD1_CUCSA; Uncharacterized protein
STRINGPOPTR_0019s14130.12e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.12e-53myb domain protein 7
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]